PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_31326_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 380aa    MW: 42029.9 Da    PI: 5.8376
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_31326_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.81.6e-17202256256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Neem_31326_f_1 202 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 256
                     778899***********************************************98 PP

2HD-ZIP_I/II1284.1e-41202292192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  Neem_31326_f_1 202 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-ALK 292
                     69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-17185259IPR009057Homeodomain-like
SuperFamilySSF466894.02E-18196259IPR009057Homeodomain-like
PROSITE profilePS5007116.811198258IPR001356Homeobox domain
SMARTSM003893.7E-15200262IPR001356Homeobox domain
CDDcd000864.46E-16202259No hitNo description
PfamPF000465.1E-15202256IPR001356Homeobox domain
PROSITE patternPS000270233256IPR017970Homeobox, conserved site
CDDcd146860.00373249290No hitNo description
PfamPF021835.9E-11258292IPR003106Leucine zipper, homeobox-associated
SMARTSM003409.1E-26258301IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MELGLSLGDT PKPFGFMEKS HEVSSNKGLG FCMGLSIGQS VAEELDLLPN TPVPRNQLAS  60
FLPFPWTSDN ANTDEANKTS VVDCEKRSSS VDPPIQLDLL PNAPVPRNQL ASFLPFPWTS  120
DNGQMVRGFD VNKFPLAEEP EDGAALSSSP NNSAASSFQM DFCIYSSGGN KKDIESGGMG  180
NEIEAERASS RVSDEDENGC TRKKLRLSKE QSAFLEESFK EHNTLNPKQK LALAKQLNLR  240
PRQVEVWFQN RRARTKLKQT EVDCEYLKRC CETLTEENRR LHKELQELRA LKTSNPFYMQ  300
LPATTLTMCP SCERVATTTN SNACGSGAAT TTTNISDPTS TTTGFSLSRP RFFPFSQNQN  360
QQTTSSSSRD QIGKHVEKSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1200206TRKKLRL
2250258RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002314223.21e-144hypothetical protein POPTR_0009s02850g
RefseqXP_011002298.11e-144PREDICTED: homeobox-leucine zipper protein HOX11-like
SwissprotP466651e-96HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLB9HPS01e-144B9HPS0_POPTR; Uncharacterized protein
STRINGPOPTR_0009s02850.11e-143(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49282852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-78homeobox from Arabidopsis thaliana